Lineage for d1t89c2 (1t89 C:87-171)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787102Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 787111Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
    Uniprot O75015 23-189
  8. 787119Domain d1t89c2: 1t89 C:87-171 [106662]
    Other proteins in same PDB: d1t89a1, d1t89a2, d1t89b1, d1t89b2
    complexed with fuc, gal, man, nag

Details for d1t89c2

PDB Entry: 1t89 (more details), 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)
PDB Compounds: (C:) low affinity immunoglobulin gamma fc region receptor III-b

SCOP Domain Sequences for d1t89c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t89c2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

SCOP Domain Coordinates for d1t89c2:

Click to download the PDB-style file with coordinates for d1t89c2.
(The format of our PDB-style files is described here.)

Timeline for d1t89c2: