Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries) Uniprot O75015 23-189 |
Domain d1t89c1: 1t89 C:5-86 [106661] Other proteins in same PDB: d1t89a1, d1t89a2, d1t89b1, d1t89b2 |
PDB Entry: 1t89 (more details), 3.5 Å
SCOPe Domain Sequences for d1t89c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t89c1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn dsgeyrcqtnlstlsdpvqlev
Timeline for d1t89c1:
View in 3D Domains from other chains: (mouse over for more information) d1t89a1, d1t89a2, d1t89b1, d1t89b2 |