SCOPe 2.08: Domain d1t89c1: 1t89 C:5-86

Lineage for d1t89c1 (1t89 C:5-86)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
   Uniprot O75015 23-189

8. Domain d1t89c1: 1t89 C:5-86 [106661]
   Other proteins in same PDB: d1t89a1, d1t89a2, d1t89b1, d1t89b2

Details for d1t89c1

PDB Entry: 1t89, 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)

PDB Compounds: (C:) low affinity immunoglobulin gamma fc region receptor III-b

SCOPe Domain Sequences for d1t89c1:

Sequence; same for both SEQRES and ATOM records:

>d1t89c1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
dsgeyrcqtnlstlsdpvqlev

Timeline for d1t89c1:

• d1t89c1 first appeared in SCOP 1.69
  
• d1t89c1 appears in SCOPe 2.07