SCOP 1.71: Domain d1t89a2: 1t89 A:342-443

Lineage for d1t89a2 (1t89 A:342-443)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)

8. Domain d1t89a2: 1t89 A:342-443 [106658]
   Other proteins in same PDB: d1t89a1, d1t89b1, d1t89c1, d1t89c2

Details for d1t89a2

PDB Entry: 1t89, 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)

SCOP Domain Sequences for d1t89a2:

Sequence; same for both SEQRES and ATOM records:

>d1t89a2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1t89a2:

• d1t89a2 first appeared in SCOP 1.69
  
• d1t89a2 appears in SCOP 1.73
  
• d1t89a2 appears in the current release, SCOPe 2.08