SCOP 1.69: Domain d1t89a1: 1t89 A:235-341

Lineage for d1t89a1 (1t89 A:235-341)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)

8. Domain d1t89a1: 1t89 A:235-341 [106657]
   Other proteins in same PDB: d1t89a2, d1t89b2, d1t89c1, d1t89c2

Details for d1t89a1

PDB Entry: 1t89, 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)

SCOP Domain Sequences for d1t89a1:

Sequence; same for both SEQRES and ATOM records:

>d1t89a1 b.1.1.2 (A:235-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d1t89a1:

• d1t89a1 is new in SCOP 1.69
  
• d1t89a1 appears in SCOP 1.71
  
• d1t89a1 appears in the current release, SCOPe 2.08