Lineage for d1t88a_ (1t88 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646437Protein Cytochrome P450-CAM [48266] (1 species)
  7. 646438Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries)
  8. 646464Domain d1t88a_: 1t88 A: [106655]

Details for d1t88a_

PDB Entry: 1t88 (more details), 1.9 Å

PDB Description: crystal structure of the ferrous cytochrome p450cam (c334a)
PDB Compounds: (A:) Cytochrome P450-cam

SCOP Domain Sequences for d1t88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t88a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
ggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1t88a_:

Click to download the PDB-style file with coordinates for d1t88a_.
(The format of our PDB-style files is described here.)

Timeline for d1t88a_: