Lineage for d1t87a_ (1t87 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331248Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2331249Species Pseudomonas putida [TaxId:303] [48267] (118 PDB entries)
    Uniprot P00183
  8. 2331343Domain d1t87a_: 1t87 A: [106653]
    complexed with cam, cmo, hem, k, trs

Details for d1t87a_

PDB Entry: 1t87 (more details), 1.8 Å

PDB Description: crystal structure of the ferrous co-bound cytochrome p450cam (c334a)
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d1t87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t87a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
ggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d1t87a_:

Click to download the PDB-style file with coordinates for d1t87a_.
(The format of our PDB-style files is described here.)

Timeline for d1t87a_: