Lineage for d1t86a_ (1t86 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446992Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 446993Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 446994Family a.104.1.1: Cytochrome P450 [48265] (20 proteins)
  6. 447067Protein Cytochrome P450-CAM [48266] (1 species)
  7. 447068Species Pseudomonas putida [TaxId:303] [48267] (46 PDB entries)
  8. 447093Domain d1t86a_: 1t86 A: [106651]

Details for d1t86a_

PDB Entry: 1t86 (more details), 1.9 Å

PDB Description: crystal structure of the ferrous cytochrome p450cam mutant (l358p/c334a)

SCOP Domain Sequences for d1t86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t86a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcpgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1t86a_:

Click to download the PDB-style file with coordinates for d1t86a_.
(The format of our PDB-style files is described here.)

Timeline for d1t86a_: