Lineage for d1t86a_ (1t86 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450-CAM [48266] (1 species)
  7. Species Pseudomonas putida [TaxId:303] [48267] (121 PDB entries)
    Uniprot P00183
  8. Domain d1t86a_: 1t86 A: [106651]
    complexed with cam, hem, k; mutant

Details for d1t86a_

PDB Entry: 1t86 (more details), 1.9 Å

PDB Description: crystal structure of the ferrous cytochrome p450cam mutant (l358p/c334a)
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d1t86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t86a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlcpgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d1t86a_ are not available.

Timeline for d1t86a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t86b_