SCOP 1.69: Domain d1t84a_: 1t84 A:

Lineage for d1t84a_ (1t84 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.68: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47911] (1 superfamily)
   5 helices; irregular array; left-handed superhelix

4. Superfamily a.68.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47912] (1 family)

5. Family a.68.1.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47913] (1 protein)

6. Protein Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47914] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47915] (2 PDB entries)

8. Domain d1t84a_: 1t84 A: [106649]

Details for d1t84a_

PDB Entry: 1t84

PDB Description: solution structure of the wiskott-aldrich syndrome protein (wasp) autoinhibited core domain complexed with (s)-wiskostatin, a small molecule inhibitor

SCOP Domain Sequences for d1t84a_:

Sequence; same for both SEQRES and ATOM records:

>d1t84a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens)}
sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag

Timeline for d1t84a_:

• d1t84a_ is new in SCOP 1.69
  
• d1t84a_ appears in SCOP 1.71
  
• d1t84a_ appears in the current release, SCOPe 2.08