Lineage for d1t84a_ (1t84 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000211Fold a.68: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47911] (1 superfamily)
    5 helices; irregular array; left-handed superhelix
  4. 2000212Superfamily a.68.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47912] (1 family) (S)
  5. 2000213Family a.68.1.1: Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47913] (1 protein)
  6. 2000214Protein Wiscott-Aldrich syndrome protein, WASP, C-terminal domain [47914] (1 species)
  7. 2000215Species Human (Homo sapiens) [TaxId:9606] [47915] (2 PDB entries)
    Uniprot P42768 241-309
  8. 2000217Domain d1t84a_: 1t84 A: [106649]
    complexed with wsk

Details for d1t84a_

PDB Entry: 1t84 (more details)

PDB Description: Solution structure of the Wiskott-Aldrich Syndrome Protein (WASP) autoinhibited core domain complexed with (S)-wiskostatin, a small molecule inhibitor
PDB Compounds: (A:) wiskott-aldrich syndrome protein

SCOPe Domain Sequences for d1t84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t84a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sgfkhvshvgwdpqngfdvnnldpdlrslfsragiseaqltdaetskliydfiedqggle
avrqemrrqggsggsqsseglvgalmhvmqkrsraihssdegedqag

SCOPe Domain Coordinates for d1t84a_:

Click to download the PDB-style file with coordinates for d1t84a_.
(The format of our PDB-style files is described here.)

Timeline for d1t84a_: