Lineage for d1t83c1 (1t83 C:5-86)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031580Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2031589Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
    Uniprot O75015 23-189
  8. 2031594Domain d1t83c1: 1t83 C:5-86 [106647]
    Other proteins in same PDB: d1t83a1, d1t83a2, d1t83b1, d1t83b2
    complexed with hg2

Details for d1t83c1

PDB Entry: 1t83 (more details), 3 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (orthorhombic)
PDB Compounds: (C:) low affinity immunoglobulin gamma fc region receptor III-b

SCOPe Domain Sequences for d1t83c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t83c1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
dsgeyrcqtnlstlsdpvqlev

SCOPe Domain Coordinates for d1t83c1:

Click to download the PDB-style file with coordinates for d1t83c1.
(The format of our PDB-style files is described here.)

Timeline for d1t83c1: