Lineage for d1t83c1 (1t83 C:5-86)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454679Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454688Species Human (Homo sapiens), III [TaxId:9606] [49199] (7 PDB entries)
  8. 454693Domain d1t83c1: 1t83 C:5-86 [106647]
    Other proteins in same PDB: d1t83a1, d1t83a2, d1t83b1, d1t83b2

Details for d1t83c1

PDB Entry: 1t83 (more details), 3 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (orthorhombic)

SCOP Domain Sequences for d1t83c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t83c1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
dsgeyrcqtnlstlsdpvqlev

SCOP Domain Coordinates for d1t83c1:

Click to download the PDB-style file with coordinates for d1t83c1.
(The format of our PDB-style files is described here.)

Timeline for d1t83c1: