![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d1t83b1: 1t83 B:235-341 [106645] Other proteins in same PDB: d1t83a2, d1t83b2, d1t83c1, d1t83c2 complexed with hg2 |
PDB Entry: 1t83 (more details), 3 Å
SCOPe Domain Sequences for d1t83b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t83b1 b.1.1.2 (B:235-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d1t83b1:
![]() Domains from other chains: (mouse over for more information) d1t83a1, d1t83a2, d1t83c1, d1t83c2 |