| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries) |
| Domain d1t83a1: 1t83 A:235-341 [106643] Other proteins in same PDB: d1t83a2, d1t83b2, d1t83c1, d1t83c2 |
PDB Entry: 1t83 (more details), 3 Å
SCOP Domain Sequences for d1t83a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t83a1 b.1.1.2 (A:235-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d1t83a1:
View in 3DDomains from other chains: (mouse over for more information) d1t83b1, d1t83b2, d1t83c1, d1t83c2 |