Lineage for d1t82d_ (1t82 D:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502577Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502578Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 502657Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)
  6. 502706Protein Putative thioesterase SO4397 [110898] (1 species)
  7. 502707Species Shewanella oneidensis [TaxId:70863] [110899] (1 PDB entry)
  8. 502711Domain d1t82d_: 1t82 D: [106642]
    Structural genomics target

Details for d1t82d_

PDB Entry: 1t82 (more details), 1.7 Å

PDB Description: crystal structure of the putative thioesterase from shewanella oneidensis, northeast structural genomics target sor51

SCOP Domain Sequences for d1t82d_:

Sequence, based on SEQRES records: (download)

>d1t82d_ d.38.1.5 (D:) Putative thioesterase SO4397 {Shewanella oneidensis}
mdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimt
ltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrkakvk
levqlfcdgklcaqfdglyvsvp

Sequence, based on observed residues (ATOM records): (download)

>d1t82d_ d.38.1.5 (D:) Putative thioesterase SO4397 {Shewanella oneidensis}
mdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimt
ltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpqrgrkakvklevqlfc
dgklcaqfdglyvsvp

SCOP Domain Coordinates for d1t82d_:

Click to download the PDB-style file with coordinates for d1t82d_.
(The format of our PDB-style files is described here.)

Timeline for d1t82d_: