Lineage for d1t82c_ (1t82 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550920Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2551017Protein Putative thioesterase SO4397 [110898] (1 species)
  7. 2551018Species Shewanella oneidensis [TaxId:70863] [110899] (1 PDB entry)
    Uniprot Q8E989
  8. 2551021Domain d1t82c_: 1t82 C: [106641]
    Other proteins in same PDB: d1t82b2
    Structural genomics target

Details for d1t82c_

PDB Entry: 1t82 (more details), 1.7 Å

PDB Description: crystal structure of the putative thioesterase from shewanella oneidensis, northeast structural genomics target sor51
PDB Compounds: (C:) hypothetical acetyltransferase

SCOPe Domain Sequences for d1t82c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t82c_ d.38.1.5 (C:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]}
dellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytimtl
tgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrkakvkl
evqlfcdgklcaqfdglyvsvpkm

SCOPe Domain Coordinates for d1t82c_:

Click to download the PDB-style file with coordinates for d1t82c_.
(The format of our PDB-style files is described here.)

Timeline for d1t82c_: