SCOPe 2.08: Domain d1t82b1: 1t82 B:-2-143

Lineage for d1t82b1 (1t82 B:-2-143)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Putative thioesterase SO4397 [110898] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [110899] (1 PDB entry)
   Uniprot Q8E989

8. Domain d1t82b1: 1t82 B:-2-143 [106640]
   Other proteins in same PDB: d1t82b2
   Structural genomics target

Details for d1t82b1

PDB Entry: 1t82, 1.7 Å

PDB Description: crystal structure of the putative thioesterase from shewanella oneidensis, northeast structural genomics target sor51

PDB Compounds: (B:) hypothetical acetyltransferase

SCOPe Domain Sequences for d1t82b1:

Sequence; same for both SEQRES and ATOM records:

>d1t82b1 d.38.1.5 (B:-2-143) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]}
hmdellnrlrqtwhstipvsefmqiaplsftdgelsvsaplapninlhhtmfagsiytim
tltgwgmvwlqqqllnvdgdivladahirylapvtsapevkvrwpdtnlsplqrgrkakv
klevqlfcdgklcaqfdglyvsvp

Timeline for d1t82b1:

• d1t82b1 first appeared in SCOP 1.69, called d1t82b_
  
• d1t82b1 appears in SCOPe 2.07