Lineage for d1t7qa1 (1t7q A:30-405)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874661Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2874683Protein Carnitine acetyltransferase, N-terminal domain [418982] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 2874687Species Mouse (Mus musculus) [TaxId:10090] [419452] (9 PDB entries)
    Uniprot P47934
  8. 2874688Domain d1t7qa1: 1t7q A:30-405 [106631]
    Other proteins in same PDB: d1t7qa2, d1t7qa3, d1t7qb2, d1t7qb3
    complexed with 152, coa, edo; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1t7qa1

PDB Entry: 1t7q (more details), 1.8 Å

PDB Description: crystal structure of the f565a mutant of murine carnitine acetyltransferase in complex with carnitine and coa
PDB Compounds: (A:) carnitine acetyltransferase

SCOPe Domain Sequences for d1t7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7qa1 c.43.1.3 (A:30-405) Carnitine acetyltransferase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
kndiekakqnlsimiq

SCOPe Domain Coordinates for d1t7qa1:

Click to download the PDB-style file with coordinates for d1t7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1t7qa1: