![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
![]() | Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
![]() | Protein Carnitine acetyltransferase, N-terminal domain [418982] (2 species) relative spatial position of the domains is similar to the monomers in CAT trimer |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [419452] (9 PDB entries) Uniprot P47934 |
![]() | Domain d1t7oa1: 1t7o A:30-405 [106629] Other proteins in same PDB: d1t7oa2, d1t7oa3 complexed with 152; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1t7o (more details), 2.3 Å
SCOPe Domain Sequences for d1t7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7oa1 c.43.1.3 (A:30-405) Carnitine acetyltransferase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei kndiekakqnlsimiq
Timeline for d1t7oa1: