SCOPe 2.08: Domain d1t7oa1: 1t7o A:30-405

Lineage for d1t7oa1 (1t7o A:30-405)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (6 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Carnitine acetyltransferase, N-terminal domain [418982] (2 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Mouse (Mus musculus) [TaxId:10090] [419452] (9 PDB entries)
   Uniprot P47934

8. Domain d1t7oa1: 1t7o A:30-405 [106629]
   Other proteins in same PDB: d1t7oa2, d1t7oa3
   complexed with 152; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1t7oa1

PDB Entry: 1t7o, 2.3 Å

PDB Description: crystal structure of the m564g mutant of murine carnitine acetyltransferase in complex with carnitine

PDB Compounds: (A:) carnitine acetyltransferase

SCOPe Domain Sequences for d1t7oa1:

Sequence; same for both SEQRES and ATOM records:

>d1t7oa1 c.43.1.3 (A:30-405) Carnitine acetyltransferase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
kndiekakqnlsimiq

Timeline for d1t7oa1:

• d1t7oa1 first appeared in SCOP 1.69
  
• d1t7oa1 appears in SCOPe 2.07