| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) ![]() |
| Family c.43.1.3: Choline/Carnitine O-acyltransferase (Pfam 00755) [82424] (2 proteins) monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
| Protein Carnitine acetyltransferase [82425] (2 species) relative spatial position of the domains is similar to the monomers in CAT trimer |
| Species Mouse (Mus musculus) [TaxId:10090] [82426] (6 PDB entries) |
| Domain d1t7na2: 1t7n A:406-625 [106628] |
PDB Entry: 1t7n (more details), 1.9 Å
SCOP Domain Sequences for d1t7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7na2 c.43.1.3 (A:406-625) Carnitine acetyltransferase {Mouse (Mus musculus)}
dldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqacatyesaslrmfhlgrt
dtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdrairgeafdrhllglkl
qaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvgffgpvvpdgygicynpmeahi
nfsvsaynscaetnaarmahylekalldmrtllqnhprak
Timeline for d1t7na2: