SCOP 1.69: Domain d1t7na2: 1t7n A:406-625

Lineage for d1t7na2 (1t7n A:406-625)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase (Pfam 00755) [82424] (2 proteins)
   monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Carnitine acetyltransferase [82425] (2 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Mouse (Mus musculus) [TaxId:10090] [82426] (6 PDB entries)

8. Domain d1t7na2: 1t7n A:406-625 [106628]

Details for d1t7na2

PDB Entry: 1t7n, 1.9 Å

PDB Description: crystal structure of the m564g mutant of murine crat

SCOP Domain Sequences for d1t7na2:

Sequence; same for both SEQRES and ATOM records:

>d1t7na2 c.43.1.3 (A:406-625) Carnitine acetyltransferase {Mouse (Mus musculus)}
dldimmltfhhfgkdfpkseklspdafiqvalqlayyriygqacatyesaslrmfhlgrt
dtirsasidslafvkgmgdstvpeqqkvellrkavqahraytdrairgeafdrhllglkl
qaiedlvsmpdifmdtsyaiamhfnlstsqvpaktdcvgffgpvvpdgygicynpmeahi
nfsvsaynscaetnaarmahylekalldmrtllqnhprak

Timeline for d1t7na2:

• d1t7na2 is new in SCOP 1.69
  
• d1t7na2 appears in SCOP 1.71
  
• d1t7na2 appears in the current release, SCOPe 2.08