Lineage for d1t7na1 (1t7n A:30-405)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486085Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 486086Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 486161Family c.43.1.3: Choline/Carnitine O-acyltransferase (Pfam 00755) [82424] (2 proteins)
    monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 486162Protein Carnitine acetyltransferase [82425] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 486168Species Mouse (Mus musculus) [TaxId:10090] [82426] (6 PDB entries)
  8. 486173Domain d1t7na1: 1t7n A:30-405 [106627]

Details for d1t7na1

PDB Entry: 1t7n (more details), 1.9 Å

PDB Description: Crystal structure of the M564G mutant of murine CrAT

SCOP Domain Sequences for d1t7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7na1 c.43.1.3 (A:30-405) Carnitine acetyltransferase {Mouse (Mus musculus)}
ahqdalprlpvpplqqsldyylkalqpivseeewahtkqlvdefqtsggvgerlqkgler
rakkmenwlsewwlktaylqfrqpvviysspgvilpkqdfvdlqgqlrfaakliegvldf
ksmidnetlpveflggqplcmnqyyqilsscrvpgpkqdsvvnflkskrppthitvvhny
qffeldvyhsdgtpltsdqifvqlekiwnsslqsnkepvgiltsnhrntwakaynnlikd
kvnresvnsiqksiftvcldkqvprvsddvyrnhvagqmlhgggskfnsgnrwfdktlqf
ivaedgscgmvyehaaaegppivalvdhvmeytkkpelvrspmvplpmpkklrfnitpei
kndiekakqnlsimiq

SCOP Domain Coordinates for d1t7na1:

Click to download the PDB-style file with coordinates for d1t7na1.
(The format of our PDB-style files is described here.)

Timeline for d1t7na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7na2