Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein Scorpion toxin [57097] (17 species) |
Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (11 PDB entries) Uniprot P45697 |
Domain d1t7ea1: 1t7e A:1-64 [106624] Other proteins in same PDB: d1t7ea2 complexed with po4; mutant |
PDB Entry: 1t7e (more details), 1.4 Å
SCOPe Domain Sequences for d1t7ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7ea1 g.3.7.1 (A:1-64) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1 [TaxId: 34649]} vrdayiakshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp gkch
Timeline for d1t7ea1: