Lineage for d1t7ea1 (1t7e A:1-64)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030457Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 3030473Protein Scorpion toxin [57097] (17 species)
  7. 3030496Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (11 PDB entries)
    Uniprot P45697
  8. 3030501Domain d1t7ea1: 1t7e A:1-64 [106624]
    Other proteins in same PDB: d1t7ea2
    complexed with po4; mutant

Details for d1t7ea1

PDB Entry: 1t7e (more details), 1.4 Å

PDB Description: crystal structure of mutant pro9ser of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
PDB Compounds: (A:) Alpha-like neurotoxin BmK-I

SCOPe Domain Sequences for d1t7ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7ea1 g.3.7.1 (A:1-64) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1 [TaxId: 34649]}
vrdayiakshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
gkch

SCOPe Domain Coordinates for d1t7ea1:

Click to download the PDB-style file with coordinates for d1t7ea1.
(The format of our PDB-style files is described here.)

Timeline for d1t7ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7ea2