SCOPe 2.08: Domain d1t7ea1: 1t7e A:1-64

Lineage for d1t7ea1 (1t7e A:1-64)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)

6. Protein Scorpion toxin [57097] (17 species)

7. Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (11 PDB entries)
   Uniprot P45697

8. Domain d1t7ea1: 1t7e A:1-64 [106624]
   Other proteins in same PDB: d1t7ea2
   complexed with po4; mutant

Details for d1t7ea1

PDB Entry: 1t7e, 1.4 Å

PDB Description: crystal structure of mutant pro9ser of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch

PDB Compounds: (A:) Alpha-like neurotoxin BmK-I

SCOPe Domain Sequences for d1t7ea1:

Sequence; same for both SEQRES and ATOM records:

>d1t7ea1 g.3.7.1 (A:1-64) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1 [TaxId: 34649]}
vrdayiakshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
gkch

Timeline for d1t7ea1:

• d1t7ea1 first appeared in SCOP 1.69, called d1t7ea_
  
• d1t7ea1 appears in SCOPe 2.07