Lineage for d1t7db_ (1t7d B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471633Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 471634Superfamily b.87.1: LexA/Signal peptidase [51306] (2 families) (S)
  5. 471665Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
    contains additional all-beta subdomain inserted in the superfamily fold
  6. 471666Protein Type 1 signal peptidase [51313] (1 species)
  7. 471667Species Escherichia coli [TaxId:562] [51314] (3 PDB entries)
  8. 471677Domain d1t7db_: 1t7d B: [106623]

Details for d1t7db_

PDB Entry: 1t7d (more details), 2.47 Å

PDB Description: Crystal structure of Escherichia coli type I signal peptidase in complex with a lipopeptide inhibitor

SCOP Domain Sequences for d1t7db_:

Sequence, based on SEQRES records: (download)

>d1t7db_ b.87.1.2 (B:) Type 1 signal peptidase {Escherichia coli}
iyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkypedp
kldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfsrr
nggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqqla
twivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrlsri
ggih

Sequence, based on observed residues (ATOM records): (download)

>d1t7db_ b.87.1.2 (B:) Type 1 signal peptidase {Escherichia coli}
iyepfqipsgsmmptlligdfilvekfaetghpkrgdivvfkypedpkldyikravglpg
dkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfssgffevpknetkeng
irlserketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsad
srywgfvpeanlvgrataiwmsfdkqegewptglrlsriggih

SCOP Domain Coordinates for d1t7db_:

Click to download the PDB-style file with coordinates for d1t7db_.
(The format of our PDB-style files is described here.)

Timeline for d1t7db_: