Lineage for d1t7da_ (1t7d A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073181Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 2073182Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 2073219Family b.87.1.2: Type 1 signal peptidase [51312] (1 protein)
    contains additional all-beta subdomain inserted in the superfamily fold
  6. 2073220Protein Type 1 signal peptidase [51313] (1 species)
  7. 2073221Species Escherichia coli [TaxId:562] [51314] (5 PDB entries)
    Uniprot P00803 81-324
  8. 2073232Domain d1t7da_: 1t7d A: [106622]
    complexed with m12

Details for d1t7da_

PDB Entry: 1t7d (more details), 2.47 Å

PDB Description: Crystal structure of Escherichia coli type I signal peptidase in complex with a lipopeptide inhibitor
PDB Compounds: (A:) Signal peptidase I

SCOPe Domain Sequences for d1t7da_:

Sequence, based on SEQRES records: (download)

>d1t7da_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
iyepfqipsgsmmptlligdfilvekfaygikdpiyqktlietghpkrgdivvfkypedp
kldyikravglpgdkvtydpvskeltiqpgcssgqacenalpvtysnvepsdfvqtfsrr
nggeatsgffevpknetkengirlserketlgdvthriltvpiaqdqvgmyyqqpgqqla
twivppgqyfmmgdnrdnsadsrywgfvpeanlvgrataiwmsfdkqegewptglrlsri
ggih

Sequence, based on observed residues (ATOM records): (download)

>d1t7da_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]}
iyepfqipsgsmmptlligdfilvekfhpkrgdivvfkypedpkldyikravglpgdkvt
ydpvskeltiqpgcnalpvtysnvepsdfvqtfsrreatsgffevpknetkengirlser
ketlgdvthriltvpiaqdqvgmyyqqpgqqlatwivppgqyfmmgdnrdnsadsrywgf
vpeanlvgrataiwmsfdlrlsriggih

SCOPe Domain Coordinates for d1t7da_:

Click to download the PDB-style file with coordinates for d1t7da_.
(The format of our PDB-style files is described here.)

Timeline for d1t7da_: