Lineage for d1t7ba_ (1t7b A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521435Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 521436Family g.3.7.1: Long-chain scorpion toxins [57096] (4 proteins)
  6. 521449Protein Scorpion toxin [57097] (16 species)
  7. 521472Species Chinese scorpion (Buthus martensii), toxin m1 [TaxId:34649] [57106] (5 PDB entries)
  8. 521478Domain d1t7ba_: 1t7b A: [106621]

Details for d1t7ba_

PDB Entry: 1t7b (more details), 1.85 Å

PDB Description: crystal structure of mutant lys8gln of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch

SCOP Domain Sequences for d1t7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7ba_ g.3.7.1 (A:) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m1}
nsvrdayiaqphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpir
vpgkch

SCOP Domain Coordinates for d1t7ba_:

Click to download the PDB-style file with coordinates for d1t7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1t7ba_: