Lineage for d1t79a_ (1t79 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543422Protein Androgen receptor [63621] (3 species)
  7. 543423Species Chimpanzee (Pan troglodytes) [TaxId:9598] [109986] (8 PDB entries)
  8. 543428Domain d1t79a_: 1t79 A: [106619]
    complexed with dht

Details for d1t79a_

PDB Entry: 1t79 (more details), 1.8 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with a FxxLW motif

SCOP Domain Sequences for d1t79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t79a_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes)}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOP Domain Coordinates for d1t79a_:

Click to download the PDB-style file with coordinates for d1t79a_.
(The format of our PDB-style files is described here.)

Timeline for d1t79a_: