Lineage for d1t79a_ (1t79 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Androgen receptor [63621] (4 species)
  7. Species Chimpanzee (Pan troglodytes) [TaxId:9598] [109986] (8 PDB entries)
    Uniprot O97775 661-910 # 100% sequence identity to human sequence (Uniprot P10275 669-918)
  8. Domain d1t79a_: 1t79 A: [106619]
    complexed with dht

Details for d1t79a_

PDB Entry: 1t79 (more details), 1.8 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with a FxxLW motif
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1t79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t79a_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOPe Domain Coordinates for d1t79a_ are not available.

Timeline for d1t79a_: