Lineage for d1t76a_ (1t76 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448073Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 448074Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 448075Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (30 proteins)
  6. 448076Protein Androgen receptor [63621] (3 species)
  7. 448077Species Chimpanzee (Pan troglodytes) [TaxId:9598] [109986] (8 PDB entries)
  8. 448084Domain d1t76a_: 1t76 A: [106618]

Details for d1t76a_

PDB Entry: 1t76 (more details), 2.1 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with a WxxVW motif

SCOP Domain Sequences for d1t76a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t76a_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes)}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

SCOP Domain Coordinates for d1t76a_:

Click to download the PDB-style file with coordinates for d1t76a_.
(The format of our PDB-style files is described here.)

Timeline for d1t76a_: