Lineage for d1t75e_ (1t75 E:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488011Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 488024Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (1 family) (S)
  5. 488025Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (1 protein)
  6. 488026Protein beta-carbonic anhydrase [53058] (4 species)
  7. 488034Species Escherichia coli [TaxId:562] [64085] (3 PDB entries)
  8. 488041Domain d1t75e_: 1t75 E: [106617]

Details for d1t75e_

PDB Entry: 1t75 (more details), 2.5 Å

PDB Description: Crystal structure of Escherichia coli beta carbonic anhydrase

SCOP Domain Sequences for d1t75e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t75e_ c.53.2.1 (E:) beta-carbonic anhydrase {Escherichia coli}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklk

SCOP Domain Coordinates for d1t75e_:

Click to download the PDB-style file with coordinates for d1t75e_.
(The format of our PDB-style files is described here.)

Timeline for d1t75e_: