Lineage for d1t75b_ (1t75 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490902Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2490967Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2490968Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2490969Protein beta-carbonic anhydrase [53058] (4 species)
  7. 2490970Species Escherichia coli [TaxId:562] [64085] (4 PDB entries)
    Uniprot P61517
  8. 2490975Domain d1t75b_: 1t75 B: [106615]
    complexed with zn

Details for d1t75b_

PDB Entry: 1t75 (more details), 2.5 Å

PDB Description: Crystal structure of Escherichia coli beta carbonic anhydrase
PDB Compounds: (B:) Protein yadF

SCOPe Domain Sequences for d1t75b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t75b_ c.53.2.1 (B:) beta-carbonic anhydrase {Escherichia coli [TaxId: 562]}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklk

SCOPe Domain Coordinates for d1t75b_:

Click to download the PDB-style file with coordinates for d1t75b_.
(The format of our PDB-style files is described here.)

Timeline for d1t75b_: