SCOP 1.75: Domain d1t6zb2: 1t6z B:302-458

Lineage for d1t6zb2 (1t6z B:302-458)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)

6. Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
   Uniprot Q9WZW1
   TM0379

8. Domain d1t6zb2: 1t6z B:302-458 [106611]
   Other proteins in same PDB: d1t6za1, d1t6zb1
   complexed with rbf

Details for d1t6zb2

PDB Entry: 1t6z, 2.4 Å

PDB Description: Crystal structure of riboflavin bound TM379

PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOP Domain Sequences for d1t6zb2:

Sequence; same for both SEQRES and ATOM records:

>d1t6zb2 c.26.1.3 (B:302-458) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

Timeline for d1t6zb2:

• d1t6zb2 first appeared in SCOP 1.69
  
• d1t6zb2 appears in SCOP 1.73
  
• d1t6zb2 appears in SCOPe 2.01
  
• d1t6zb2 appears in the current release, SCOPe 2.08