Lineage for d1t6zb1 (1t6z B:459-589)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561246Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) (S)
  5. 561247Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)
  6. 561262Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 561263Species Thermotoga maritima [TaxId:243274] [101787] (5 PDB entries)
    TM0379
  8. 561271Domain d1t6zb1: 1t6z B:459-589 [106610]
    Other proteins in same PDB: d1t6za2, d1t6zb2
    complexed with rbf

Details for d1t6zb1

PDB Entry: 1t6z (more details), 2.4 Å

PDB Description: Crystal structure of riboflavin bound TM379

SCOP Domain Sequences for d1t6zb1:

Sequence, based on SEQRES records: (download)

>d1t6zb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records): (download)

>d1t6zb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima}
yfeiegivhfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyild
fegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

SCOP Domain Coordinates for d1t6zb1:

Click to download the PDB-style file with coordinates for d1t6zb1.
(The format of our PDB-style files is described here.)

Timeline for d1t6zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6zb2