SCOP 1.71: Domain d1t6xa2: 1t6x A:2-158

Lineage for d1t6xa2 (1t6x A:2-158)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)

6. Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [102261] (5 PDB entries)
   TM0379

8. Domain d1t6xa2: 1t6x A:2-158 [106601]
   Other proteins in same PDB: d1t6xa1, d1t6xb1

Details for d1t6xa2

PDB Entry: 1t6x, 2.29 Å

PDB Description: Crystal structure of ADP bound TM379

SCOP Domain Sequences for d1t6xa2:

Sequence; same for both SEQRES and ATOM records:

>d1t6xa2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

Timeline for d1t6xa2:

• d1t6xa2 first appeared in SCOP 1.69
  
• d1t6xa2 appears in SCOP 1.73
  
• d1t6xa2 appears in the current release, SCOPe 2.08