Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) |
Family c.26.1.3: Adenylyltransferase [52397] (5 proteins) |
Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species) |
Species Thermotoga maritima [TaxId:243274] [102261] (5 PDB entries) TM0379 |
Domain d1t6xa2: 1t6x A:2-158 [106601] Other proteins in same PDB: d1t6xa1, d1t6xb1 |
PDB Entry: 1t6x (more details), 2.29 Å
SCOP Domain Sequences for d1t6xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6xa2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima} vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve vyeiedvvvqgkrvssslirnlvqegrveeipaylgr
Timeline for d1t6xa2: