Lineage for d1t6xa2 (1t6x A:2-158)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. Domain d1t6xa2: 1t6x A:2-158 [106601]
    Other proteins in same PDB: d1t6xa1, d1t6xb1
    complexed with adp

Details for d1t6xa2

PDB Entry: 1t6x (more details), 2.29 Å

PDB Description: Crystal structure of ADP bound TM379
PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1t6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6xa2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

SCOPe Domain Coordinates for d1t6xa2 are not available.

Timeline for d1t6xa2:

Domains from same chain:
(mouse over for more information)
d1t6xa1
Domains from other chains:
(mouse over for more information)
d1t6xb1, d1t6xb2