Lineage for d1t6vo_ (1t6v O:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741840Protein Novel antigen receptor (against lysozyme) [110042] (1 species)
  7. 2741841Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries)
    Uniprot Q8AXI4 # fragment
  8. 2741844Domain d1t6vo_: 1t6v O: [106599]
    Other proteins in same PDB: d1t6vl_, d1t6vm_
    complexed with cl

Details for d1t6vo_

PDB Entry: 1t6v (more details), 1.7 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor (NAR) variable domain in complex with lysozyme
PDB Compounds: (O:) novel antigen receptor

SCOPe Domain Sequences for d1t6vo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6vo_ b.1.1.1 (O:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns
gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn

SCOPe Domain Coordinates for d1t6vo_:

Click to download the PDB-style file with coordinates for d1t6vo_.
(The format of our PDB-style files is described here.)

Timeline for d1t6vo_: