SCOPe 2.08: Domain d1t6vo_: 1t6v O:

Lineage for d1t6vo_ (1t6v O:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Novel antigen receptor (against lysozyme) [110042] (1 species)

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries)
   Uniprot Q8AXI4 # fragment

8. Domain d1t6vo_: 1t6v O: [106599]
   Other proteins in same PDB: d1t6vl_, d1t6vm_
   complexed with cl

Details for d1t6vo_

PDB Entry: 1t6v, 1.7 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor (NAR) variable domain in complex with lysozyme

PDB Compounds: (O:) novel antigen receptor

SCOPe Domain Sequences for d1t6vo_:

Sequence; same for both SEQRES and ATOM records:

>d1t6vo_ b.1.1.1 (O:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns
gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn

Timeline for d1t6vo_:

• d1t6vo_ first appeared in SCOP 1.69
  
• d1t6vo_ appears in SCOPe 2.07