Lineage for d1t6vn_ (1t6v N:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 452455Protein Novel antigen receptor (against lysozyme) [110042] (1 species)
  7. 452456Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (2 PDB entries)
  8. 452458Domain d1t6vn_: 1t6v N: [106598]
    Other proteins in same PDB: d1t6vl_, d1t6vm_

Details for d1t6vn_

PDB Entry: 1t6v (more details), 1.7 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor (NAR) variable domain in complex with lysozyme

SCOP Domain Sequences for d1t6vn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6vn_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum)}
rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns
gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn

SCOP Domain Coordinates for d1t6vn_:

Click to download the PDB-style file with coordinates for d1t6vn_.
(The format of our PDB-style files is described here.)

Timeline for d1t6vn_: