![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Novel antigen receptor (against lysozyme) [110042] (1 species) |
![]() | Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries) Uniprot Q8AXI4 # fragment |
![]() | Domain d1t6vn_: 1t6v N: [106598] Other proteins in same PDB: d1t6vl_, d1t6vm_ complexed with cl |
PDB Entry: 1t6v (more details), 1.7 Å
SCOPe Domain Sequences for d1t6vn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6vn_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn
Timeline for d1t6vn_: