Lineage for d1t6uf_ (1t6u F:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 440973Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
  5. 440974Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (1 protein)
  6. 440975Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 440976Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries)
  8. 440982Domain d1t6uf_: 1t6u F: [106589]

Details for d1t6uf_

PDB Entry: 1t6u (more details), 1.3 Å

PDB Description: nickel superoxide dismutase (nisod) native 1.30 a structure

SCOP Domain Sequences for d1t6uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6uf_ a.24.22.1 (F:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor}
hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetk

SCOP Domain Coordinates for d1t6uf_:

Click to download the PDB-style file with coordinates for d1t6uf_.
(The format of our PDB-style files is described here.)

Timeline for d1t6uf_: