| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) ![]() automatically mapped to Pfam PF09055 |
| Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
| Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species) |
| Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries) Uniprot P80735 |
| Domain d1t6ud_: 1t6u D: [106587] complexed with ni |
PDB Entry: 1t6u (more details), 1.3 Å
SCOPe Domain Sequences for d1t6ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6ud_ a.24.22.1 (D:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]}
hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
Timeline for d1t6ud_: