SCOPe 2.08: Domain d1t6t2_: 1t6t 2:

Lineage for d1t6t2_ (1t6t 2:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)

5. Family c.136.1.1: Toprim domain [110456] (3 proteins)
   Pfam PF01751

6. Protein Hypothetical protein aq_2086 [110457] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [110458] (1 PDB entry)
   Uniprot O67859

8. Domain d1t6t2_: 1t6t 2: [106583]
   Structural genomics target

Details for d1t6t2_

PDB Entry: 1t6t, 1.8 Å

PDB Description: putative protein from aquifex aeolicus

PDB Compounds: (2:) Putative protein

SCOPe Domain Sequences for d1t6t2_:

Sequence; same for both SEQRES and ATOM records:

>d1t6t2_ c.136.1.1 (2:) Hypothetical protein aq_2086 {Aquifex aeolicus [TaxId: 63363]}
eprnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmlegkwe
kvillfdldthgerinqkmkellssqgflvdenfrnflkkwniihieein

Timeline for d1t6t2_:

• d1t6t2_ first appeared in SCOP 1.69
  
• d1t6t2_ appears in SCOPe 2.07