Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.136: Toprim domain [110454] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.136.1: Toprim domain [110455] (1 family) this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731) |
Family c.136.1.1: Toprim domain [110456] (3 proteins) Pfam PF01751 |
Protein Hypothetical protein aq_2086 [110457] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [110458] (1 PDB entry) Uniprot O67859 |
Domain d1t6t1_: 1t6t 1: [106582] Structural genomics target |
PDB Entry: 1t6t (more details), 1.8 Å
SCOPe Domain Sequences for d1t6t1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6t1_ c.136.1.1 (1:) Hypothetical protein aq_2086 {Aquifex aeolicus [TaxId: 63363]} prnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmlegkwek villfdldthgerinqkmkellssqgflvdenfrnflkkwniihieei
Timeline for d1t6t1_: