SCOPe 2.05: Domain d1t6t1_: 1t6t 1:

Lineage for d1t6t1_ (1t6t 1:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.136: Toprim domain [110454] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.136.1: Toprim domain [110455] (1 family)
   this domain is also present in several multidomain proteins that are not split in scop yet: (56712), (56719), (56726), (56731)

5. Family c.136.1.1: Toprim domain [110456] (3 proteins)
   Pfam PF01751

6. Protein Hypothetical protein aq_2086 [110457] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [110458] (1 PDB entry)
   Uniprot O67859

8. Domain d1t6t1_: 1t6t 1: [106582]
   Structural genomics target

Details for d1t6t1_

PDB Entry: 1t6t, 1.8 Å

PDB Description: putative protein from aquifex aeolicus

PDB Compounds: (1:) Putative protein

SCOPe Domain Sequences for d1t6t1_:

Sequence; same for both SEQRES and ATOM records:

>d1t6t1_ c.136.1.1 (1:) Hypothetical protein aq_2086 {Aquifex aeolicus [TaxId: 63363]}
prnlsewikelkkasreavilvegkndkkalskfsiknvidlsgkryadvvdmlegkwek
villfdldthgerinqkmkellssqgflvdenfrnflkkwniihieei

Timeline for d1t6t1_:

• d1t6t1_ first appeared in SCOP 1.69
  
• d1t6t1_ appears in SCOPe 2.04
  
• d1t6t1_ appears in SCOPe 2.06
  
• d1t6t1_ appears in the current release, SCOPe 2.08