Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) automatically mapped to Pfam PF09055 |
Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species) |
Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries) Uniprot P80735 |
Domain d1t6qc_: 1t6q C: [106581] |
PDB Entry: 1t6q (more details), 2.05 Å
SCOPe Domain Sequences for d1t6qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6qc_ a.24.22.1 (C:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]} gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
Timeline for d1t6qc_: