Lineage for d1t6qc_ (1t6q C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988258Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. 1988259Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 protein domains)
  6. 1988260Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 1988261Species Streptomyces coelicolor [TaxId:1902] [109774] (3 PDB entries)
    Uniprot P80735
  8. 1988276Domain d1t6qc_: 1t6q C: [106581]

Details for d1t6qc_

PDB Entry: 1t6q (more details), 2.05 Å

PDB Description: Nickel Superoxide Dismutase (NiSOD) CN-treated Apo Structure
PDB Compounds: (C:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d1t6qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6qc_ a.24.22.1 (C:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces coelicolor [TaxId: 1902]}
gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp
hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk

SCOPe Domain Coordinates for d1t6qc_:

Click to download the PDB-style file with coordinates for d1t6qc_.
(The format of our PDB-style files is described here.)

Timeline for d1t6qc_: