Lineage for d1t6oa_ (1t6o A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439808Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (7 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 439884Superfamily a.8.5: Phosphoprotein XD domain [101089] (1 family) (S)
  5. 439885Family a.8.5.1: Phosphoprotein XD domain [101090] (1 protein)
  6. 439886Protein RNA polymerase alpha subunit [101091] (2 species)
  7. 439887Species Measles virus [TaxId:11234] [101092] (2 PDB entries)
  8. 439889Domain d1t6oa_: 1t6o A: [106578]
    complexed with peptide from the measles virus N protein (SQ Q995N1 58-77)

Details for d1t6oa_

PDB Entry: 1t6o (more details), 2 Å

PDB Description: nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein

SCOP Domain Sequences for d1t6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6oa_ a.8.5.1 (A:) RNA polymerase alpha subunit {Measles virus}
gasrsvirsiikssrleedrkrylmtllddikgandlakfhqmlmkiim

SCOP Domain Coordinates for d1t6oa_:

Click to download the PDB-style file with coordinates for d1t6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1t6oa_: