| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.5: Phosphoprotein XD domain [101089] (1 family) ![]() |
| Family a.8.5.1: Phosphoprotein XD domain [101090] (1 protein) |
| Protein RNA polymerase alpha subunit [101091] (2 species) |
| Species Measles virus [TaxId:11234] [101092] (3 PDB entries) Uniprot Q89728 459-507 |
| Domain d1t6oa_: 1t6o A: [106578] complexed with peptide from the measles virus N protein (Uniprot Q995N1 58-77) |
PDB Entry: 1t6o (more details), 2 Å
SCOPe Domain Sequences for d1t6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6oa_ a.8.5.1 (A:) RNA polymerase alpha subunit {Measles virus [TaxId: 11234]}
gasrsvirsiikssrleedrkrylmtllddikgandlakfhqmlmkiim
Timeline for d1t6oa_: