SCOPe 2.06: Domain d1t6nb_: 1t6n B:

Lineage for d1t6nb_ (1t6n B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
   Uniprot Q13838 45-428

8. Domain d1t6nb_: 1t6n B: [106577]
   complexed with flc

Details for d1t6nb_

PDB Entry: 1t6n, 1.94 Å

PDB Description: Crystal structure of the N-terminal domain of human UAP56

PDB Compounds: (B:) Probable ATP-dependent RNA helicase

SCOPe Domain Sequences for d1t6nb_:

Sequence; same for both SEQRES and ATOM records:

>d1t6nb_ c.37.1.19 (B:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
sgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatl
qqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkkn
cphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqv
mmfsatlskeirpvcrkfmqdpmeifv

Timeline for d1t6nb_:

• d1t6nb_ first appeared in SCOP 1.69
  
• d1t6nb_ appears in SCOPe 2.05
  
• d1t6nb_ appears in SCOPe 2.07
  
• d1t6nb_ appears in the current release, SCOPe 2.08