Lineage for d1t6nb_ (1t6n B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
    Uniprot Q13838 45-428
  8. Domain d1t6nb_: 1t6n B: [106577]
    complexed with flc

Details for d1t6nb_

PDB Entry: 1t6n (more details), 1.94 Å

PDB Description: Crystal structure of the N-terminal domain of human UAP56
PDB Compounds: (B:) Probable ATP-dependent RNA helicase

SCOPe Domain Sequences for d1t6nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6nb_ c.37.1.19 (B:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
sgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatl
qqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkkn
cphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqv
mmfsatlskeirpvcrkfmqdpmeifv

SCOPe Domain Coordinates for d1t6nb_ are not available.

Timeline for d1t6nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t6na_