Lineage for d1t6na_ (1t6n A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697477Family c.37.1.19: Tandem AAA-ATPase domain [81268] (22 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 697624Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)
  7. 697625Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
  8. 697627Domain d1t6na_: 1t6n A: [106576]

Details for d1t6na_

PDB Entry: 1t6n (more details), 1.94 Å

PDB Description: Crystal structure of the N-terminal domain of human UAP56
PDB Compounds: (A:) Probable ATP-dependent RNA helicase

SCOP Domain Sequences for d1t6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
sgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatl
qqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkkn
cphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqv
mmfsatlskeirpvcrkfmqdpmeifv

SCOP Domain Coordinates for d1t6na_:

Click to download the PDB-style file with coordinates for d1t6na_.
(The format of our PDB-style files is described here.)

Timeline for d1t6na_: